50 Recent Changes in Lab Web retrieved at 14:41 (GMT)

Publications Barrick JEPublication Network Graph by 26. Barrick, J.E. , Yu, D.S., Yoon, S.H., Jeong, H, Oh, T.K., Schneider, D., Lenski, R.E., and Kim, J.F. 2009 ...

Contact Information Jeffrey E. Barrick, Ph.D. email: jbarrick at msu dot edu Research Associate Laboratory of Richard Lenski Microbiology and Molecular Genetics ...

Label Templates Templates for printing labels...

Protocols and Laboratory Reference Organization Label Templates Sequence Analysis Primer Design PCR Gene and Genomic Sequencing Bacterial ...

ASKA Collection Evolution Experiment Starting Lines 1 Revive each strain by inoculating a scrape of frozen culture from a well of a microplate into 3 ml of 0.1x ...

Home Contact Research Publications Supplements Tools Protocols Reference ' '' " then "" else ""}%

Research Interests /collage.png Overview I am broadly interested in understanding evolution as a creative force. My laboratory will use experiments with populations ...

manB cpsG deletion 1 Amplify negative and positive selection cassette encoding sacB and cat from pKO3 adding genome specific regions to each end. Try two different ...

Cloning and Strain Construction Projects Strain library evolution experiments KanR and empty PCA24N plasmids as ASKA controls Mal version of AG1 to follow ...

Pulsed Field Gel Electrophoresis Mapping Purpose: To validate mutations predicted from whole genome re sequencing and possibly discover rearrangements through repetitive ...

nop infB strain construction 1 REL606 with infB1 allele from JEB154. 1 JEB154 with ancestral REL606 allele. primer name sequence RL1041 ...

Reference Information Lenski Long Term E. coli Lines Plasmids Sequence of REL606 Installation Workarounds

Predicting Riboswitch Regulation on a Genomic Scale This page describes how to install a set of Perl scripts designed to identify members of known classes in genomic ...

nop Lab Web Preferences The following settings are web preferences of the Lab web. These preferences overwrite the site level preferences in . and ...

Genomic DNA Preparation for Whole Genome Re sequencing of E. coli Current RTSF Instrument Information 454 Pyrosequencing (GSFlex machine) Read length is 100 ...

Math::GSL 0.20 On MacBook Pro: Architecture set incorrectly to arch ppc when compiling some files due to Perl Config module. Can edit inc/GSLBuilder.pm to fix. On ...

WarningThis tool is under active development. Its capabilities and usage may change without warning, and it has not been adequately tested. nop BreSeq Bacterial ...

topA Gene Sequencing The topA gene coordinates are 1329420 1332017. The topA mutation in the Ara 1 long term line is 1329516:C T. primer who coords ...

Primer Design Primers sequences and sometimes stocks already exist for some genes: topA PCR reaction Check PCR and Quantify DNA Yields Run 2 5 µl of sample 2 ...

Commonly Used Plasmids pCA24N (ASKA strain host) pKD3 (Cam template plasmids) pKD13 (Kan template plasmids) pCR2.1 (TOPO cloning kit vector) ...

The Lenski Long Term Evolution Experiment Arabinose Marker REL606 and REL607 (the ancestral strains of the E. coli long term evolution experiment) differ by a single ...

Tools RNA Structure Mutual InformationPredict interacting bases in an RNA alignment by estimating the phylogeny corrected significance of mutual information between ...

Move Kishony cfp/yfp into REL606 background P1 transduction fails, probably due to the restriction modification system of the E. coli B derived REL606 differing ...

Materials Description Cat # Price Qiagen RNeasy Protect Bacteria Mini Kit (50) 74524 $386.00 Invitrogen Superscript Plus Indirect cDNA Labeling ...

Wiki Administration Tools and Links These pages are maintained with the TWiki collaboration tool. Web Specific Statistics ...

Predicting Riboswitch Regulation on a Genomic Scale This page describes how to install a set of Perl scripts designed to identify members of known classes in genomic ...

Interesting Links Architecture B. Dow I. Kahn (Sangsad Bhaban) Marco Cathedral to Mazes and Labyrinths Art Klein /IKB.png and Man ...

Supplementary Data and Methods Predicting riboswitch regulation on a genomic scale Perl scripts that accompany a Methods in Molecular Biology chapter describing ...

asdasdf JeffreyBarrick 20 Jun 2009

Tetrazolium marker for follow up competitions ASKA(AG1) is Ara–, Mal– Still need a marker... gene gorge deletion in ribose gene from Keio? Keio(BW25113 ...

Statistics for nop Lab Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and ...

CamR Keio control strain construction General approach: use the Datsenko and Wanner gene replacement protocol (which is how the Keio strains were constructed) to add ...

Bacterial Genetic Code (NCBI Translation Table 11) AAs FFLLSSSSYY CC WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Starts M M MMMM M Base1 TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG ...

Selecting Arabinose Marker Revertants Background The Escherichia coli B strain REL606 has a mutation in the araA gene that renders it unable to utilize the sugar ...

Protocol for Determining Mutation Rate to Phage (T5) resistance Day 2: Prepare Media/Revive/Titer Phage 1. If necessary, revive the frozen stock of each strain ...

Phage Lysate Preparation Optimized for the production of high titer T4 lysates (1010 1012 PFU/ml). It is also suitable for phages T5 and T6 but tends to give lower ...

WarningThis tool is under active development. Its capabilities and usage may change without warning, and it has not been adequately tested. Marker Divergence Experiments ...

RNA Structure Mutual Information Overview: What do these programs do? information between columns in a sequence alignment of structured RNAs can provide evidence ...

Barrick :: Home Riboswitch 2° Structure Prediction I am interested how evolutionary processes acting on different genetic architectures give rise to the creative brilliance ...

Images for use on other pages...

JeffreyBarrick .WebChangesAlert, ., .TWikiRegistration

These groups can be used to define fine grained .TWikiAccessControl in TWiki: TWikiAdminGroup Add your groups to this list and define new group topics similar ...

Local TWiki Preferences favicon: Attach a favicon.ico to a web's WebPreferences or add a FAVICON setting to WebPreferences Set FAVICON ///favicon ...

Blue Oyster Mushrooms Total Elapsed Time: ~10 days

TWiki's nop Lab web

" else " nop TWiki's nop Lab web"}% /Lab